From salad to ice cream, best vegan-friendly options to try in Vizag today
  • About
  • Advertise
  • Privacy & Policy
  • Contact
Wednesday, May 21, 2025
Yo Vizag
  • Magazine
  • News
  • People
  • Food & Drink
  • Entertainment
  • Lifestyle
  • More
    • Covid-19
      • Important Helpline Numbers
      • Hospitals in Vizag
      • Donate Plasma
    • Heritage
    • Travel
    • Beauty & Wellness
    • Behind The Name – Vizag
    • Buddhist Sites In Vizag
    • Places To See In Vizag
    • Religious Places
    • 6 must visit beaches in Visakhapatnam, Andhra Pradesh
    • Vintage Vizag
    • Visakhapatnam Pincode
    • Vizianagaram Pincode List
  • Join NowTelegram Channel
No Result
View All Result
  • Magazine
  • News
  • People
  • Food & Drink
  • Entertainment
  • Lifestyle
  • More
    • Covid-19
      • Important Helpline Numbers
      • Hospitals in Vizag
      • Donate Plasma
    • Heritage
    • Travel
    • Beauty & Wellness
    • Behind The Name – Vizag
    • Buddhist Sites In Vizag
    • Places To See In Vizag
    • Religious Places
    • 6 must visit beaches in Visakhapatnam, Andhra Pradesh
    • Vintage Vizag
    • Visakhapatnam Pincode
    • Vizianagaram Pincode List
  • Join NowTelegram Channel
No Result
View All Result
Yo Vizag
No Result
View All Result
Home Food & Drink

From salad to ice cream, best vegan-friendly options to try in Vizag today

13/07/2022
in Food & Drink, Visakhapatnam
Reading Time: 4 mins read
0
From salad to ice cream, best vegan-friendly options to try in Vizag today
Share on FacebookShare on TwitterShare on WhatsappShare on TelegramShare on RedditShare on PinterestShare on Email

Vizag, the City of Destiny, has finally opened up to new and inclusive options for vegans who not only don’t eat meat but also avoid dairy. Though a few restaurants had one or two options for quite some time now, finding good ice cream was always a hassle. Looks like the vegan culture has picked up in the city, as you can now order anything from a salad to dessert, everything vegan. Available in-restaurant and on food delivery apps, check out these vegan-friendly options available in Vizag.

Here is a list of vegan-friendly options to try in Vizag from salad to ice cream.

You might also like

Anti-Drug Awareness Park

India’s First Anti-Drug Awareness Park to Come Up in Visakhapatnam

20/05/2025
Covid 19 cases concern in Vizag, city making arrangements

Rise in COVID-19 cases in Southeast Asia: Should we be concerned?

20/05/2025

#1 Vegan salad

From salad to ice cream, best vegan-friendly options to try in Vizag todayWho said only non-vegetarians have the best source of protein? You should get them to have this vegan salad from Plenty The Kitchen of Destiny. It is packed with tofu, chickpeas, soya, and rajma (all protein-rich) and topped with some zucchini and assorted vegetables, making it the perfect salad. For all those who enjoy eating light and healthy check out their vast menu of vegan options. Another place to check out in Vizag for vegan salad would be the newly opened Fitwayz which also promises a nutrition-rich vegan salad.

#2 Vegan Garlic Bread

Yes, you read that right! Vegan garlic bread is now made possible by Bombay Pizza Company located in Dwaraka Nagar. Giving you the same creamy and cheese experience, check out their range the next time you feel left out at a pizza party.

#3 Vegan pasta

Could it get any better for all those who have to avoid dairy cause their bodies are allergic? Two restaurants in the city offer vegan pasta options. Something is better than nothing right! Check out Fitwayz and Plenty The Kitchen of Destiny for what they have to offer all vegans who love their pasta.

#4 Vegan Samosas

From salad to ice cream, best vegan-friendly options to try in Vizag todayLocated a little away from the city, I Scream Vegan is a dream come true for every vegan practitioner. They serve everything vegan from samosas to thick shakes. Make sure to try their Oreo Heaven the next to drive by NAD.

#5 Vegan milkshakes

From salad to ice cream, best vegan-friendly options to try in Vizag todayThis one got us the most excited! For someone who is lactose intolerant, it is very hard to always indulge in dairy-free shakes when you catch up with friends. For those who enjoy the lifestyle, we salute you. As mentioned above, I Scream Vegan has a good range of vegan thick shakes. Drunken Monkey on the other hand has launched a bunch of vegan milkshakes, and their date-night smoothie is our favourite! You can also check out another new restaurant Paradiso for a wide range of Vegan options.

#6 Vegan Coffee

Not everyone is a fan of black coffee otherwise called Americano. For all those who love their filter coffee hot and strong, SLAY Coffee is the perfect place to go. They also offer an option of Vegan Iced Latte for those who love cold coffees.

#7 Vegan Ice cream

Last but not the least, everyone’s favourite has got to be ice cream! Though Baskin Robbins was the go-to option for a long time for vegan ice creams, Vizag now has more. A new franchise from Delhi, Giani has been making the headline for some time now in Vizag. With some unique flavours to offer, they also have vegan options. Dark chocolate sorbet is our top pick. One of the best vegan ice cream options available in Vizag.

Let us know in the comments below how excited are you to try these Vegan-friendly options in Vizag

Tags: foodvegan foodvegan ice creamvegan milkshakesvegan optionsvegan pastavegan saladsvegan-friendlyvisakhapatnamvizag
Share352Tweet220SendShareSharePin79Send

Team Yo! Vizag

Related Posts

Anti-Drug Awareness Park
News/City Updates

India’s First Anti-Drug Awareness Park to Come Up in Visakhapatnam

20/05/2025
Covid 19 cases concern in Vizag, city making arrangements
News/City Updates

Rise in COVID-19 cases in Southeast Asia: Should we be concerned?

20/05/2025
free bus travel for women
News/City Updates

Free Bus Travel for AP Women likely to start from Independence Day: CM Naidu

19/05/2025
Army veterans set on trance-ocean journey to Vizag
News/City Updates

Two Indian Army veterans set sail to Vizag from New Zealand

19/05/2025

Discussion about this post

Popular Posts

  • 13 exciting releases today on OTT platforms to binge for solid entertainment this weekend

    13 exciting releases today on OTT platforms to binge for solid entertainment this weekend

    102384 shares
    Share 40953 Tweet 25596
  • 10 OTT releases today you must watch to keep yourself immersed in fun

    54746 shares
    Share 21898 Tweet 13686
  • 8 nerve-gripping Indian horror web series on OTT that guarantee chills

    40847 shares
    Share 16338 Tweet 10211
  • 7 exciting movies releasing on OTT this week of August to binge on a boring day

    40335 shares
    Share 16134 Tweet 10084
  • 8 brilliant Malayalam movies you must watch on Amazon Prime Video

    40282 shares
    Share 16112 Tweet 10070
Yo Vizag

Copyright © 2023. DSA Media Publications

Navigate Site

  • About
  • Advertise
  • Privacy & Policy
  • Contact

Follow Us

Vizag
No Result
View All Result
  • Magazine
  • News
  • People
  • Food & Drink
  • Entertainment
  • Lifestyle
  • More
    • Covid-19
      • Important Helpline Numbers
      • Hospitals in Vizag
      • Donate Plasma
    • Heritage
    • Travel
    • Beauty & Wellness
    • Behind The Name – Vizag
    • Buddhist Sites In Vizag
    • Places To See In Vizag
    • Religious Places
    • 6 must visit beaches in Visakhapatnam, Andhra Pradesh
    • Vintage Vizag
    • Visakhapatnam Pincode
    • Vizianagaram Pincode List
  • Join Now

Copyright © 2023. DSA Media Publications